PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EPS63427.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
Family EIL
Protein Properties Length: 594aa    MW: 66267.2 Da    PI: 6.146
Description EIL family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EPS63427.1genomeLSMUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1EIN3410.52e-125403741310
                 XXXXXXXXXXXXXXXXXXXXXXX..XXXXX.XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX CS
        EIN3   1 eelkkrmwkdqmllkrlkerkkqlledkeaatgakksnksneqarrkkmsraQDgiLkYMlkemevcnaqGfvYgiipekgkpvegasdsLraWWkekv 99 
                 e+l+krmwkd+++l+r+ke++k ++  +++a ++k+++ +++qa rkkm+raQDgiLkYMlk mevc+a+GfvYgiipekgkpv+gasd++raWWkekv
  EPS63427.1  40 EDLEKRMWKDRVKLRRIKEKQKLSV--QQSAEKQKNKSSTTDQACRKKMARAQDGILKYMLKLMEVCKARGFVYGIIPEKGKPVSGASDNIRAWWKEKV 136
                 89*****************999887..55545666678999********************************************************** PP

                 XXXXXXXXXXXXXXXXXXXXXXXXXX....XX----STTS-HHHHHHHHHHHSSSSSS-TTS--TTT--HHHH---S--HHHHHHT--TT--.-----G CS
        EIN3 100 efdrngpaaiskyqaknlilsgesslqtersseshslselqDTtlgSLLsalmqhcdppqrrfplekgvepPWWPtGkelwwgelglskdqgtppykkp 198
                 +fd+ngpaai+ky+a++l  +++ ++   + s++  l++lqD+tlgSLLs+lmqhc+ppqr++plekg++pPWWPtG+e+ww+++gl+  q  p+ykkp
  EPS63427.1 137 KFDKNGPAAIAKYEAECLSRDDDVGN--PNGSSQIVLQDLQDATLGSLLSSLMQHCNPPQRKYPLEKGTPPPWWPTGNEDWWAQMGLPIGQT-PSYKKP 232
                 *************9988766655555..5899999*****************************************************9998.9***** PP

                 GG--HHHHHHHHHHHHHHTGGGHHHHHHTTTTSSSSTTT--SHHHHHHHHHHTTTTT-S--XXXX..XX........XXXXXXXXXXXXXXXXXXXXXX CS
        EIN3 199 hdlkkawkvsvLtavikhmsptieeirelerqskylqdkmsakesfallsvlnqeekecatvsah..ss........slrkqspkvtlsceqkedvegk 287
                 hdlkk wkv+vLtavikhmsp+i++ir+l rqsk+lqdkm+akes ++ls+l++ee+ +++ +++  ss         + ++++k  +++++++dveg 
  EPS63427.1 233 HDLKKIWKVGVLTAVIKHMSPDIAKIRRLIRQSKCLQDKMTAKESLIWLSILSREEAFIRHQCSEngSSgiseapsrGHGNNKKKPCVESDSEYDVEGC 331
                 *************************************************************9999663367777654444588899999********77 PP

                 XXXX.XXXXXXXXXX....................XXXXXXXX CS
        EIN3 288 keskikhvqavktta....................gfpvvrkr 310
                  +   + ++++++++                     ++  +kr
  EPS63427.1 332 ANGLGSVSSKDQRKNpveppgrtvvkrvqgsskkhVAERPKKR 374
                 7777676677766666666666666666655544311111122 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF048732.2E-12240288No hitNo description
Gene3DG3DSA:1.10.3180.101.9E-68164294IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
SuperFamilySSF1167686.8E-60169291IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0042762Biological Processregulation of sulfur metabolic process
GO:0071281Biological Processcellular response to iron ion
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 594 aa     Download sequence    Send to blast
MATMEDVGID ISSDIEVDEI RGDGGVEEEK EVSDEEIEVE DLEKRMWKDR VKLRRIKEKQ  60
KLSVQQSAEK QKNKSSTTDQ ACRKKMARAQ DGILKYMLKL MEVCKARGFV YGIIPEKGKP  120
VSGASDNIRA WWKEKVKFDK NGPAAIAKYE AECLSRDDDV GNPNGSSQIV LQDLQDATLG  180
SLLSSLMQHC NPPQRKYPLE KGTPPPWWPT GNEDWWAQMG LPIGQTPSYK KPHDLKKIWK  240
VGVLTAVIKH MSPDIAKIRR LIRQSKCLQD KMTAKESLIW LSILSREEAF IRHQCSENGS  300
SGISEAPSRG HGNNKKKPCV ESDSEYDVEG CANGLGSVSS KDQRKNPVEP PGRTVVKRVQ  360
GSSKKHVAER PKKRKHSKSN DDLITEFNQE AVELSGVFRH RSQGETNGIR STMHHHQHDS  420
LVESSFNVTA NLGNDRNSYF PAPPPTSDFV PHDLDSIQML QDDEGSRIQH ETRNSLWRNG  480
PQGSNIDHFS SSTIPGVLYP NTATDRSAVA ALNEFNSGFQ IPVLPPQIVQ DEGYGKVAEQ  540
PEDTQFTLPL SPDLPGFSGF NLQYGDAASG GNFEFSVDVA DSVDDDYLME YFAS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wij_A8e-701682999140ETHYLENE-INSENSITIVE3-like 3 protein
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00233DAPTransfer from AT1G73730Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011090401.10.0PREDICTED: ETHYLENE INSENSITIVE 3-like 3 protein
SwissprotO231161e-165EIL3_ARATH; ETHYLENE INSENSITIVE 3-like 3 protein
TrEMBLS8DU810.0S8DU81_9LAMI; Ethylene-insensitive 3f
STRINGPOPTR_0001s05360.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA30423178
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G73730.11e-158ETHYLENE-INSENSITIVE3-like 3
Publications ? help Back to Top
  1. Leushkin EV, et al.
    The miniature genome of a carnivorous plant Genlisea aurea contains a low number of genes and short non-coding sequences.
    BMC Genomics, 2013. 14: p. 476
    [PMID:23855885]